General Information

  • ID:  hor004795
  • Uniprot ID:  P84899
  • Protein name:  (Val1, Hyp2, Thr6)bradykinyl-QS
  • Gene name:  NA
  • Organism:  Pithecopus hypochondrialis (Orange-legged leaf frog) (Phyllomedusa hypochondrialis)
  • Family:  Frog skin active peptide (FSAP) family, Bradykinin-related peptide subfamily
  • Source:  Animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Pithecopus (genus), Phyllomedusinae (subfamily), Hylidae (family), Hyloidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0090729 toxin activity
  • GO BP:  GO:0006952 defense response; GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VPPGFTPFRQS
  • Length:  11(51-61)
  • Propeptide:  MSILKKSLFLVLFLGLVSFSICEEEKREAEEEENEDEIEEQSEEKKRFEPVPPGFTPFRQS
  • Signal peptide:  MSILKKSLFLVLFLGLVSFSIC
  • Modification:  T2 4-hydroxyproline
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be essentially inactive in smooth muscle from artery, urinary bladder and uterus but displayed activity in ileum.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  455+/-10nM
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P84899-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004795_AF2.pdbhor004795_ESM.pdb

Physical Information

Mass: 141093 Formula: C58H85N15O15
Absent amino acids: ACDEHIKLMNWY Common amino acids: P
pI: 10.55 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: -44.55 Boman Index: -1549
Half-Life / Aliphatic Index: 100 hour Aliphatic Index: 26.36
Instability Index: 11907.27 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  24394432
  • Title:  Bradykinin-related peptides (BRPs) from skin secretions of three genera of phyllomedusine leaf frogs and their comparative pharmacological effects on mammalian smooth muscles.